PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G23650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 337aa    MW: 38045.8 Da    PI: 9.7584
Description Homeodomain-like transcriptional regulator
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G23650.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.22.5e-101256345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     +W++++d  + +a + +  +   +Wk+Ia  ++ g+tl+q++++++
      AT5G23650.1 12 SWSKDDDIAFEKALAIYNDKteiRWKKIATVVP-GKTLEQVIEHYN 56
                     7*****************99*************.***********7 PP

2Myb_DNA-binding37.36.4e-12121165347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W + E+ +++++ k++G+g+W++I+r+   +Rt  q+ s+ qky
      AT5G23650.1 121 PWKPFEHRQFLHGLKKYGKGDWRSISRHCVVTRTSTQVASHAQKY 165
                      8*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.386863IPR017884SANT domain
SMARTSM007176.2E-9961IPR001005SANT/Myb domain
SuperFamilySSF466895.98E-111167IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-41256IPR009057Homeodomain-like
PfamPF002496.2E-81256IPR001005SANT/Myb domain
CDDcd001673.51E-91256No hitNo description
Gene3DG3DSA:1.10.10.601.0E-9112170IPR009057Homeodomain-like
PROSITE profilePS5129415.318114170IPR017930Myb domain
SuperFamilySSF466892.09E-13115171IPR009057Homeodomain-like
SMARTSM007179.1E-6118168IPR001005SANT/Myb domain
TIGRFAMsTIGR015577.1E-14118168IPR006447Myb domain, plants
CDDcd001673.59E-8121166No hitNo description
PfamPF002492.0E-9121165IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0005660anatomyhydathode
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MNLGQEISVG SSWSKDDDIA FEKALAIYND KTEIRWKKIA TVVPGKTLEQ VIEHYNILAR  60
DVMLIESGCV RLPDYDDFLE EPNHNAFGKE RSILEGGNDR KYESKHKGKS KLKQKRRRGV  120
PWKPFEHRQF LHGLKKYGKG DWRSISRHCV VTRTSTQVAS HAQKYFAHIN SEDKKRKRPS  180
IHDITIAENK SISTKQRPIT WQKINNNGAT ASNTQANQTT LQPSLDIPIY GTHNNIWNAQ  240
ATQVISQPSQ NHPTYDAPII WNTQVASQPS ANIPMYGTST ISQPMVGPML SPFGTNLNHL  300
APSHMTSGVQ HDSVPYYSGP SAPINMDSIP YNIDLYN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-121075873RADIALIS
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184207000.0
Genevisible249820_at0.0
Expression AtlasAT5G23650-
AtGenExpressAT5G23650-
ATTED-IIAT5G23650-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G23650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G23650
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0566850.0DQ056685.1 Arabidopsis thaliana myb family transcription factor (At5g23650) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197754.10.0homeodomain-like transcriptional regulator
TrEMBLQ9LT000.0Q9LT00_ARATH; Homeodomain-like transcriptional regulator
STRINGAT5G23650.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133911628
Representative plantOGRP27517122
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]